HPA026962

KCNJ1 antibody from Sigma-Aldrich
Kir1.1, ROMK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026962
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026962, RRID:AB_10601934
Product name
Anti-KCNJ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026962
Antibody type
Polyclonal
Antigen
potassium inwardly-rectifying channel, subfamily J, member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKY
RVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRG
YDNPNFILSEVNETD
Storage
-20C
Provider Type Product Number
- No reagents -