Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003945-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003945-M01, RRID:AB_425525
- Product name
- LDHB monoclonal antibody (M01), clone 2H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant LDHB.
- Antigen sequence
MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMA
CAISILGKSLADELALVDVLEDKLKGEMMDLQHGS
LFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGE
SRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNP
VDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLM
AEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGV
SLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKL
KGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKG
MYGIENEVFLSLPCILNARGLTSDINQKLKDDEVA
QLKKSADTLWDIQKDLKDL- Isotype
- IgG
- Antibody clone number
- 2H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Membrane type 1-matrix metalloproteinase/Akt signaling axis modulates TNF-α-induced procoagulant activity and apoptosis in endothelial cells.
Pilot application of iTRAQ to the retinal disease Macular Telangiectasia.
Quantitative proteomics analysis reveals BAG3 as a potential target to suppress severe acute respiratory syndrome coronavirus replication.
Ohkawara H, Ishibashi T, Sugimoto K, Ikeda K, Ogawa K, Takeishi Y
PloS one 2014;9(8):e105697
PloS one 2014;9(8):e105697
Pilot application of iTRAQ to the retinal disease Macular Telangiectasia.
Len AC, Powner MB, Zhu L, Hageman GS, Song X, Fruttiger M, Gillies MC
Journal of proteome research 2012 Feb 3;11(2):537-53
Journal of proteome research 2012 Feb 3;11(2):537-53
Quantitative proteomics analysis reveals BAG3 as a potential target to suppress severe acute respiratory syndrome coronavirus replication.
Zhang L, Zhang ZP, Zhang XE, Lin FS, Ge F
Journal of virology 2010 Jun;84(12):6050-9
Journal of virology 2010 Jun;84(12):6050-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LDHB monoclonal antibody (M01), clone 2H6 Western Blot analysis of LDHB expression in Hela ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LDHB is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to LDHB on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to LDHB on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol