Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AV48210 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-LDHB antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- synthetic peptide corresponding to a region of human LDHB with an internal ID of S22808
- Description
- affinity isolated antibody
- Reactivity
- Human
- Antigen sequence
ENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKK
SADTLWDIQKDLKDL- Storage
- -20C
Submitted references Oxidative stress in cancer associated fibroblasts drives tumor-stroma co-evolution: A new paradigm for understanding tumor metabolism, the field effect and genomic instability in cancer cells.
Martinez-Outschoorn UE, Balliet RM, Rivadeneira DB, Chiavarina B, Pavlides S, Wang C, Whitaker-Menezes D, Daumer KM, Lin Z, Witkiewicz AK, Flomenberg N, Howell A, Pestell RG, Knudsen ES, Sotgia F, Lisanti MP
Cell cycle (Georgetown, Tex.) 2010 Aug 15;9(16):3256-76
Cell cycle (Georgetown, Tex.) 2010 Aug 15;9(16):3256-76
No comments: Submit comment
No validations: Submit validation data