Antibody data
- Antibody Data
 - Antigen structure
 - References [1]
 - Comments [0]
 - Validations [0]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - AV48210 - Provider product page

 - Provider
 - MilliporeSigma / Merck KGaA
 - Product name
 - Anti-LDHB antibody produced in rabbit
 - Antibody type
 - Polyclonal
 - Antigen
 - synthetic peptide corresponding to a region of human LDHB with an internal ID of S22808
 - Description
 - affinity isolated antibody
 - Reactivity
 - Human
 - Antigen sequence
 ENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKK
SADTLWDIQKDLKDL- Storage
 - -20C
 
Submitted references		Oxidative stress in cancer associated fibroblasts drives tumor-stroma co-evolution: A new paradigm for understanding tumor metabolism, the field effect and genomic instability in cancer cells.
				
		
	
			Martinez-Outschoorn UE, Balliet RM, Rivadeneira DB, Chiavarina B, Pavlides S, Wang C, Whitaker-Menezes D, Daumer KM, Lin Z, Witkiewicz AK, Flomenberg N, Howell A, Pestell RG, Knudsen ES, Sotgia F, Lisanti MP
Cell cycle (Georgetown, Tex.) 2010 Aug 15;9(16):3256-76
		Cell cycle (Georgetown, Tex.) 2010 Aug 15;9(16):3256-76
				No comments: Submit comment	
	
			
			No validations: Submit validation data