SAB2102221

SLC5A7 antibody from MilliporeSigma / Merck KGaA
CHT1, hCHT
No application information provided.

Antibody data

Product number
SAB2102221
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2102221, RRID:AB_10610861
Product name
Anti-SLC5A7 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2102221
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_068587.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLF
ESGTLPPKLDVFDAV
Storage
-20C
Provider Type Product Number
- No reagents -