Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008575-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008575-M01, RRID:AB_425767
- Product name
- PRKRA monoclonal antibody (M01), clone 1B9-1A7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PRKRA.
- Antigen sequence
MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTP
IQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRV
TVGDITCTGEGTSKKLAKHRAAEAAINILKANASI
CFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGW
RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGA
SKKQAKRNAAEKFLAKFSNISPENHISLTNVVGHS
LGCTWHSLRNSPGEKINLLKRSLLSIPNTDYIQLL
SEIAKEQGFNITYLDIDELSANGQYQCLAELSTSP
ITVCHGSGISCGNAQSDAAHNALQYLKIIAERK- Isotype
- IgG
- Antibody clone number
- 1B9-1A7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Knock-down of core proteins regulating microRNA biogenesis has no effect on sensitivity of lung cancer cells to ionizing radiation.
Surova O, Akbar NS, Zhivotovsky B
PloS one 2012;7(3):e33134
PloS one 2012;7(3):e33134
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PRKRA monoclonal antibody (M01), clone 1B9-1A7. Western Blot analysis of PRKRA expression in human liver.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PRKRA monoclonal antibody (M01), clone 1B9-1A7 Western Blot analysis of PRKRA expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PRKRA expression in transfected 293T cell line by PRKRA monoclonal antibody (M01), clone 1B9-1A7.Lane 1: PRKRA transfected lysate(34.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PRKRA is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of PRKRA transfected lysate using anti-PRKRA monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PRKRA MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PRKRA on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PRKRA on formalin-fixed paraffin-embedded human squamous cell carcinoma. [antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol