Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183963 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRKRA antibody: synthetic peptide directed towards the middle region of human PRKRA
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGA
SKKQA KRNAAEKFLA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Interaction between PKR and PACT mediated by LPS-inducible NF-κB in human gingival cells.
The role of PACT in the RNA silencing pathway.
Yoshida K, Okamura H, Hoshino Y, Shono M, Yoshioka M, Hinode D, Yoshida H
Journal of cellular biochemistry 2012 Jan;113(1):165-73
Journal of cellular biochemistry 2012 Jan;113(1):165-73
The role of PACT in the RNA silencing pathway.
Lee Y, Hur I, Park SY, Kim YK, Suh MR, Kim VN
The EMBO journal 2006 Feb 8;25(3):522-32
The EMBO journal 2006 Feb 8;25(3):522-32
No comments: Submit comment
No validations: Submit validation data