HPA029961

REPS1 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029961
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029961, RRID:AB_10603233
Product name
Anti-REPS1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029961
Antibody type
Polyclonal
Antigen
RALBP1 associated Eps domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEMELKRTGSDHTNPTSPLLVKPSDLLEENKINSS
VKFASGNTVADGYSSSDSFTSDPEQIGSNVTRQRS
HSGTSPDNTAPP
Storage
-20C
Provider Type Product Number
- No reagents -