PAB15688

GCC2 antibody from Abnova Corporation
GCC185, KIAA0336
No application information provided.

Antibody data

Product number
PAB15688
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB15688, RRID:AB_10678498
Product name
Gcc2 polyclonal antibody
Provider product page
Abnova Corporation - PAB15688
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against partial recombinant Gcc2.
Antigen sequence
KVRVHNVLKQQKNKSVSQVETEGAKQEREHLEMLI
DQLKIKLQDSQNSLQISVSEYQTLQAEHDTLLERH
NRMLQETVTKEAELREKLCSVQSENTMMKSEHSQT
MCQLTSQNEALRTSFRDQVRHLQDEHRKTVETLQH
QLSKLEAQLFQLKSEPSTRSPASSHQPSKSLRERR
TTDLPLLDMHTVAREEGEGMETTDSESVSSAGTHI
QSLEQLLSSPDTKLERLAETSLWHNEFTKEELA
Storage
Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -