Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007804-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007804-M01, RRID:AB_606539
- Product name
- LRP8 monoclonal antibody (M01), clone 3H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LRP8.
- Antigen sequence
KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDE
SEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEK
DCEGGADEAGCATLCAPH- Isotype
- IgG
- Antibody clone number
- 3H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references PCSK9 is not involved in the degradation of LDL receptors and BACE1 in the adult mouse brain.
Liu M, Wu G, Baysarowich J, Kavana M, Addona GH, Bierilo KK, Mudgett JS, Pavlovic G, Sitlani A, Renger JJ, Hubbard BK, Fisher TS, Zerbinatti CV
Journal of lipid research 2010 Sep;51(9):2611-8
Journal of lipid research 2010 Sep;51(9):2611-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged LRP8 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol