H00007804-M02

LRP8 antibody from Abnova Corporation
APOER2, HSZ75190, LRP-8, MCI1

Antibody data

Product number
H00007804-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007804-M02, RRID:AB_1576887
Product name
LRP8 monoclonal antibody (M02), clone 1A1
Provider product page
Abnova Corporation - H00007804-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant LRP8.
Antigen sequence
KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDE
SEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEK
DCEGGADEAGCATLCAPH
Isotype
IgG
Antibody clone number
1A1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -