Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006626-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006626-M01, RRID:AB_425687
- Product name
- SNRPA monoclonal antibody (M01), clone 3F9-1F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SNRPA.
- Antigen sequence
MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFS
QFGQILDILVSRSLKMRGQAFVIFKEVSSATNALR
SMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERD
RKREKRKPKSQETPATKKAVQGGGATPVVGAVQGP
VPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGL
APGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHIL
FLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHD
IAFVEFDNEVQAGAARDALQGFKITQNNAMKISFA
KK- Isotype
- IgG
- Antibody clone number
- 3F9-1F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SNRPA monoclonal antibody (M01), clone 3F9-1F7 Western Blot analysis of SNRPA expression in Hela ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SNRPA expression in transfected 293T cell line by SNRPA monoclonal antibody (M01), clone 3F9-1F7.Lane 1: SNRPA transfected lysate(31.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SNRPA is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SNRPA on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SNRPA on formalin-fixed paraffin-embedded human heart tissue. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol