Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006768-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006768-M05, RRID:AB_607100
- Product name
- ST14 monoclonal antibody (M05), clone 2F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ST14.
- Antigen sequence
PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFF
QLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCT
WNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKD- Isotype
- IgG
- Antibody clone number
- 2F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Novel surface targets and serum biomarkers from the ovarian cancer vasculature.
Sasaroli D, Gimotty PA, Pathak HB, Hammond R, Kougioumtzidou E, Katsaros D, Buckanovich R, Devarajan K, Sandaltzopoulos R, Godwin AK, Scholler N, Coukos G
Cancer biology & therapy 2011 Aug 1;12(3):169-80
Cancer biology & therapy 2011 Aug 1;12(3):169-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ST14 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol