Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405807 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Transmembrane Protein 48 (TMEM48) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TMEM48 antibody: synthetic peptide directed towards the middle region of human TMEM48
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PPIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGH
PHNWT AISRECLNLL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Heart failure induces significant changes in nuclear pore complex of human cardiomyocytes.
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
Tarazón E, Rivera M, Roselló-Lletí E, Molina-Navarro MM, Sánchez-Lázaro IJ, España F, Montero JA, Lago F, González-Juanatey JR, Portolés M
PloS one 2012;7(11):e48957
PloS one 2012;7(11):e48957
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M
Cell 2006 Nov 3;127(3):635-48
Cell 2006 Nov 3;127(3):635-48
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting