Antibody data

Product number
H00170689-M02
Provider
Abnova Corporation
Product name
ADAMTS15 monoclonal antibody (M02), clone 5F3
Provider product page
Abnova Corporation - H00170689-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ADAMTS15.
Antigen sequence
AVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTW
ELSAWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQ
CNLHRKPQELDFCVLRPC
Isotype
IgG
Antibody clone number
5F3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.