H00001733-M01

DIO1 antibody from Abnova Corporation
TXDI1
No application information provided.

Antibody data

Product number
H00001733-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001733-M01, RRID:AB_1204270
Product name
DIO1 monoclonal antibody (M01), clone 1E4
Provider product page
Abnova Corporation - H00001733-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DIO1.
Antigen sequence
DRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQ
YFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQR
CNIWEFMQGNRPLVLNFGSCT
Isotype
IgG
Antibody clone number
1E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -