HPA024190

PGM1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024190
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024190, RRID:AB_1855266
Product name
Anti-PGM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024190
Antibody type
Polyclonal
Antigen
Phosphoglucomutase-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRL
YIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQE
RTGRTAPT
Storage
-20C
Provider Type Product Number
- No reagents -