HPA031659

FUCA2 antibody from MilliporeSigma / Merck KGaA
dJ20N2.5, MGC1314
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031659
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031659, RRID:AB_10600661
Product name
Anti-FUCA2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031659
Antibody type
Polyclonal
Antigen
fucosidase, alpha-L- 2, plasma recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSS
FHKRQFPVSKTLPELYELVNNYQPEVLWSDG
Storage
-20C
Provider Type Product Number
- No reagents -