HPA024201

DDX6 antibody from Sigma-Aldrich
HLR2, RCK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024201
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024201, RRID:AB_10603562
Product name
Anti-DDX6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024201
Antibody type
Polyclonal
Antigen
DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQ
MNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKTL
KLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGI
FEMGWEKPSPIQ
Storage
-20C
Provider Type Product Number
- No reagents -