HPA026644

DDX6 antibody from MilliporeSigma / Merck KGaA
HLR2, RCK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026644
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026644, RRID:AB_1847582
Product name
Anti-DDX6 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026644
Antibody type
Polyclonal
Antigen
Probable ATP-dependent RNA helicase DDX6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EESIPIALSGRDILARAKNGTGKSGAYLIPLLERL
DLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGG
AKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILD
LIKKGVAKVDHVQMIVLDEADKLLSQD
Storage
-20C
Provider Type Product Number
- No reagents -