H00204801-B01

NLRP11 antibody from Abnova Corporation
CLR19.6, NALP11, NOD17, PAN10, PYPAF6

Antibody data

Product number
H00204801-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00204801-B01, RRID:AB_1204716
Product name
NALP11 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00204801-B01
Antibody type
Polyclonal
Antigen
NALP11 (NP_659444, 1 a.a. ~ 1033 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MAESDSTDFDLLWYLENLSDKEFQSFKKYLARKIL
DFKLPQFPLIQMTKEELANVLPISYEGQYIWNMLF
SIFSMMRKEDLCRKIIGRRNRNQEACKAVMRRKFM
LQWESHTFGKFHYKFFRDVSSDVFYILQLAYDSTS
YYSANNLNVFLMGERASGKTIVINLAVLRWIKGEM
WQNMISYVVHLTSHEINQMTNSSLAELIAKDWPDG
QAPIADILSDPKKLLFILEDLDNIRFELNVNESAL
CSNSTQKVPIPVLLVSLLKRKMAPGCWFLISSRPT
RGNNVKTFLKEVDCCTTLQLSNGKREIYFNSFFKD
RQRASAALQLVHEDEILVGLCRVAILCWITCTVLK
RQMDKGRDFQLCCQTPTDLHAHFLADALTSEAGLT
ANQYHLGLLKRLCLLAAGGLFLSTLNFSGEDLRCV
GFTEADVSVLQAANILLPSNTHKDRYKFIHLNVQE
FCTAIAFLMAVPNYLIPSGSREYKEKREQYSDFNQ
VFTFIFGLLNANRRKILETSFGYQLPMVDSFKWYS
VGYMKHLDRDPEKLTHHMPLFYCLYENREEEFVKT
IVDALMEVTVYLQSDKDMMVSLYCLDYCCHLRTLK
LSVQRIFQNKEPLIRPTASQMKSLVYWREICSLFY
TMESLRELHIFDNDLNGISERILSKALEHSSCKLR
TLKLSYVSTASGFEDLLKALARNRSLTYLSINCTS
ISLNMFSLLHDILHEPTCQISHLSLMKCDLRASEC
EEIASLLISGGSLRKLTLSSNPLRSDGMNILCDAL
LHPNCTLISLVLVFCCLTENCCSALGRVLLFSPTL
RQLDLCVNRLKNYGVLHVTFPLLFPTCQLEELHLS
GCFFSSDICQYIAIVIATNEKLRSLEIGSNKIEDA
GMQLLCGGLRHPNCMLVNIGLEECMLTSACCRSLA
SVLTTNKTLERLNLLQNHLGNDGVAKLLESLISPD
CVLKVVGLPLTGLNTQTQQLLMTVKERKPSLIFLS
ETWSLKEGREIGVTPASQPGSIIPNSNLDYMFFKF
PRMSAAMRTSNTASRQPL
Vial size
50 μl
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -