Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010049-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010049-M01, RRID:AB_425825
- Product name
- DNAJB6 monoclonal antibody (M01), clone 2C11-C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant DNAJB6.
- Antigen sequence
MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKN
PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGK
EGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFG
GRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSF
FSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSF
SSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVE
NGQERVEVEEDGQLKSLTINGKEQLLRLDNK- Isotype
- IgG
- Antibody clone number
- 2C11-C1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Interaction between urokinase receptor and heat shock protein MRJ enhances cell adhesion.
De Bock CE, Lin Z, Mekkawy AH, Byrne JA, Wang Y
International journal of oncology 2010 May;36(5):1155-63
International journal of oncology 2010 May;36(5):1155-63
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DNAJB6 monoclonal antibody (M01), clone 2C11-C1 Western Blot analysis of DNAJB6 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of DNAJB6 expression in transfected 293T cell line by DNAJB6 monoclonal antibody (M01), clone 2C11-C1.Lane 1: DNAJB6 transfected lysate(27 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DNAJB6 monoclonal antibody (M01), clone 2C11-C1. Western Blot analysis of DNAJB6 expression in C32 ( Cat # L002V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DNAJB6 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to DNAJB6 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol