HPA005696

CHADL antibody from Atlas Antibodies
SLRR4B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005696
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005696, RRID:AB_1079724
Product name
Anti-CHADL
Provider product page
Atlas Antibodies - HPA005696
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LEGAPRLGYLYLERNRFLQVPGAALRALPSLFSLH
LQDNAVDRLAPGDLGRTRALRWVYLSGNRITEVSL
GALGPARELEKLHLDRNQLREVPTGALEGLPALLE
LQLSGNPLRALRDGAFQPVGRSL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -