HPA005696

CHADL antibody from Sigma-Aldrich
SLRR4B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005696
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005696, RRID:AB_1079724
Product name
Anti-CHADL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005696
Antibody type
Polyclonal
Antigen
Chondroadherin-like protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEGAPRLGYLYLERNRFLQVPGAALRALPSLFSLH
LQDNAVDRLAPGDLGRTRALRWVYLSGNRITEVSL
GALGPARELEKLHLDRNQLREVPTGALEGLPALLE
LQLSGNPLRALRDGAFQPVGRSL
Storage
-20C
Provider Type Product Number
- No reagents -