Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501817 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 28 Homolog (Mouse) (ZFP28) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZFP28 antibody: synthetic peptide directed towards the middle region of human ZFP28
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
RKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQT
AHLAH HQRIHTGESS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification and characterization of two novel zinc finger genes, ZNF359 and ZFP28, in human development.
Zhou L, Zhu C, Luo K, Li Y, Pi H, Yuan W, Wang Y, Huang C, Liu M, Wu X
Biochemical and biophysical research communications 2002 Jul 26;295(4):862-8
Biochemical and biophysical research communications 2002 Jul 26;295(4):862-8
No comments: Submit comment
No validations: Submit validation data