HPA028314

PARS2 antibody from MilliporeSigma / Merck KGaA
DKFZp727A071
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028314
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028314, RRID:AB_10603981
Product name
Anti-PARS2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028314
Antibody type
Polyclonal
Antigen
prolyl-tRNA synthetase 2, mitochondrial (putative) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLPVDIGEDRLAICPRCSFSANMETLDLSQMNCPA
CQGPLTKTKGIEVGHTFYLGTKYSSIFNAQFTNVC
GKPTLAE
Storage
-20C
Provider Type Product Number
- No reagents -