Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007083-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007083-M02, RRID:AB_437067
- Product name
- TK1 monoclonal antibody (M02), clone F12
- Antibody type
- Monoclonal
- Antigen
- TK1 (AAH07986.1, 1 a.a. ~ 234 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTE
LMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDR
NTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDI
VEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLV
PLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVI
GGADKYHSVCRLCYFKKASGQPAGPDNKENCPVPG
KPGEAVAARKLFAPQQILQCSPAN- Isotype
- IgG
- Vial size
- 100 µg
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Correlations of (18)F-fluorothymidine uptake with pathological tumour size, Ki-67 and thymidine kinase 1 expressions in primary and metastatic lymph node colorectal cancer foci.
The histone deacetylase inhibitor PXD101 increases the efficacy of irinotecan in in vitro and in vivo colon cancer models.
Early assessment of tumor response to JAC106, an anti-tubulin agent, by 3'-deoxy-3'-[¹⁸F]fluorothymidine in preclinical tumor models.
Induction of thymidine kinase 1 after 5-fluorouracil as a mechanism for 3'-deoxy-3'-[18F]fluorothymidine flare.
Nakajo M, Nakajo M, Kajiya Y, Goto Y, Jinguji M, Tanaka S, Fukukura Y, Tani A, Higashi M
European radiology 2014 Dec;24(12):3199-209
European radiology 2014 Dec;24(12):3199-209
The histone deacetylase inhibitor PXD101 increases the efficacy of irinotecan in in vitro and in vivo colon cancer models.
Na YS, Jung KA, Kim SM, Hong YS, Ryu MH, Jang SJ, Moon DH, Cho DH, Kim JC, Lee JS, Kim TW
Cancer chemotherapy and pharmacology 2011 Aug;68(2):389-98
Cancer chemotherapy and pharmacology 2011 Aug;68(2):389-98
Early assessment of tumor response to JAC106, an anti-tubulin agent, by 3'-deoxy-3'-[¹⁸F]fluorothymidine in preclinical tumor models.
Lee SJ, Kang HY, Kim SY, Chung JH, Oh SJ, Ryu JS, Kim SB, Kang JS, Park SK, Kim HM, Kim MH, Moon DH
European journal of nuclear medicine and molecular imaging 2011 Aug;38(8):1436-48
European journal of nuclear medicine and molecular imaging 2011 Aug;38(8):1436-48
Induction of thymidine kinase 1 after 5-fluorouracil as a mechanism for 3'-deoxy-3'-[18F]fluorothymidine flare.
Lee SJ, Kim SY, Chung JH, Oh SJ, Ryu JS, Hong YS, Kim TW, Moon DH
Biochemical pharmacology 2010 Nov 15;80(10):1528-36
Biochemical pharmacology 2010 Nov 15;80(10):1528-36
No comments: Submit comment
No validations: Submit validation data