Antibody data

Product number
H00084085-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084085-A01, RRID:AB_463023
Product name
FBXO30 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00084085-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant FBXO30.
Antigen sequence
MVILQWGKRKYPEGNSSWQIKEKVWRFSTAFCSVN
EWKFADILSMADHLKKCSYNVVEKREEAIPLPCMC
VTRELTKEGRSLRSVLKPVL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.