Antibody data

Product number
H00084085-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084085-B01, RRID:AB_1113678
Product name
FBXO30 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00084085-B01
Antibody type
Polyclonal
Antigen
FBXO30 (NP_115521.3, 1 a.a. ~ 745 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPL
VCGAVFHSCKADEHRLLCPFERVPCLNSDFGCPFT
MARNKVAEHLEMCPASVVCCTMEWNRWPVSYADRK
SYENLSRDVDEVAQLDMALALQDQRMLLESLKVAT
MMSKATDKVSKPREQISVKSSVPEIPHANGLVSVD
EESYGALYQATVETTRSLAAALDILNTATRDIGML
NTSVPNDMDEQQNARESLEDQNLKDQDHLYEEEIG
AVGGIDYNDTNQNAQSEQNGSSDLLCDLNTSSYDT
SALCNGFPLENICTQVIDQNQNLHGDSKQSNLTNG
DCVASSDGTSKPSSSLAVAAQLREIIPSSALPNGT
VQHILMPDDEGEGELCWKKVDLGDVKNVDVLSFSH
APSFNFLSNSCWSKPKEDKAVDTSDLEVAEDPMGL
QGIDLITAALLFCLGDSPGGRGISDSRMADIYHID
VGTQTFSLPSAILATSTMVGEIASASACDHANPQL
SNPSPFQTLGLDLVLECVARYQPKQRSMFTFVCGQ
LFRRKEFSSHFKNVHGDIHAGLNGWMEQRCPLAYY
GCTYSQRRFCPSIQGAKIIHDRHLRSFGVQPCVST
VLVEPARNCVLGLHNDHLSSLPFEVLQHIAGFLDG
FSLCQLSCVSKLMRDVCGSLLQSRGMVILQWGKRK
YPEGNSSWQIKEKVWRFSTAFCSVNEWKFADILSM
ADHLKKCSYNVVEKREEAIPLPCMCVTRELTKEGR
SLRSVLKPVL
Vial size
50 μl
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.