SAB1400730

FBXO30 antibody from MilliporeSigma / Merck KGaA
Fbx30, MGC21674
ELISA
Recommended by provider

Antibody data

Product number
SAB1400730
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-FBXO30 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1400730
Antibody type
Polyclonal
Antigen
FBXO30 (NP_115521.3, a.a. 1-745) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPL
VCGAVFHSCKADEHRLLCPFERVPCLNSDFGCPFT
MARNKVAEHLEMCPASVVCCTMEWNRWPVSYADRK
SYENLSRDVDEVAQLDMALALQDQRMLLESLKVAT
MMSKATDKVSKPREQISVKSSVPEIPHANGLVSVD
EESYGALYQATVETTRSLAAALDILNTATRDIGML
NTSVPNDMDEQQNARESLEDQNLKDQDHLYEEEIG
AVGGIDYNDTNQNAQSEQNGSSDLLCDLNTSSYDT
SALCNGFPLENICTQVIDQNQNLHGDSKQSNLTNG
DCVASSDGTSKPSSSLAVAAQLREIIPSSALPNGT
VQHILMPDDEGEGELCWKKVDLGDVKNVDVLSFSH
APSFNFLSNSCWSKPKEDKAVDTSDLEVAEDPMGL
QGIDLITAALLFCLGDSPGGRGISDSRMADIYHID
Storage
-20C