HPA028826

DHCR24 antibody from MilliporeSigma / Merck KGaA
DCE, KIAA0018, seladin-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028826
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028826, RRID:AB_10601263
Product name
Anti-DHCR24 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028826
Antibody type
Polyclonal
Antigen
24-dehydrocholesterol reductase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILEVDTKKQIVRVEPLVTMGQVTALLTSIGWTLPV
LPELDDLTVGGLIMGTGIESSSHKYGLFQHICTAY
ELVLADGSFVRCTPSENSDLFYAVPWSCGTLGFLV
AAEIRIIPAKKYVKLRFEPVRGLEAICAKFTHESQ
Storage
-20C
Provider Type Product Number
- No reagents -