HPA026723

USP24 antibody from Sigma-Aldrich
KIAA1057
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026723
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026723, RRID:AB_10599851
Product name
Anti-USP24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026723
Antibody type
Polyclonal
Antigen
ubiquitin specific peptidase 24 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGICVRQQSVSTKDSLIAGEALSLLVTCLQLRSQQ
LASFYNLPCVADFIIDILLGSPSAEIRRVACDQLY
TLSQTDTSAHPDVQKPNQFLLGVILTAQ
Storage
-20C
Provider Type Product Number
- No reagents -