HPA034575

ZIM3 antibody from MilliporeSigma / Merck KGaA
ZNF657
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034575
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034575, RRID:AB_10603463
Product name
Anti-ZIM3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034575
Antibody type
Polyclonal
Antigen
zinc finger, imprinted 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NYSNLVSVGQGETTKPDVILRLEQGKEPWLEEEEV
LGSGRAEKNGDIGGQIWKPKDVKESLAREVPSINK
ETLTTQKGVECDGSKK
Storage
-20C
Provider Type Product Number
- No reagents -