WH0006789M1

STK4 antibody from Sigma-Aldrich
KRS2, MST1, YSK3
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0006789M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0006789M1, RRID:AB_1842535
Product name
Monoclonal Anti-STK4 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0006789M1
Antibody type
Monoclonal
Antigen
STK4 (AAH05231, a.a. 1-40) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEK
LGEG* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -