Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006789-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006789-M02, RRID:AB_535059
- Product name
- STK4 monoclonal antibody (M02), clone 4F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STK4.
- Antigen sequence
AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDW
KIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIE
EIRQKYQSKRQPILDAIEAKKRRQQ- Isotype
- IgG
- Antibody clone number
- 4F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STK4 monoclonal antibody (M02), clone 4F4 Western Blot analysis of STK4 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STK4 monoclonal antibody (M02), clone 4F4. Western Blot analysis of STK4 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STK4 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to STK4 on HeLa cell. [antibody concentration 25 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between TP53 and STK4. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-STK4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)