HPA015270

STK4 antibody from Sigma-Aldrich
KRS2, MST1, YSK3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015270
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015270, RRID:AB_1854150
Product name
Anti-STK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015270
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQ
PAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSD
WKIPQDGDYEF
Storage
-20C
Provider Type Product Number
- No reagents -