Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA036196 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA036196, RRID:AB_10670676
- Product name
- Anti-MERTK
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESK
PLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQ
DTTISWWKDGKELLGAHHAITQFY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references MERTK as a novel therapeutic target in head and neck cancer
MerTK is a novel therapeutic target in gastric cancer
von Mässenhausen A, Sanders C, Thewes B, Deng M, Queisser A, Vogel W, Kristiansen G, Duensing S, Schröck A, Bootz F, Brossart P, Kirfel J, Heasley L, Brägelmann J, Perner S
Oncotarget 2016;7(22):32678-32694
Oncotarget 2016;7(22):32678-32694
MerTK is a novel therapeutic target in gastric cancer
Yi J, Jang J, Cho J, Do I, Hong M, Kim S, Kim K, Lee S, Park S, Park J, Park Y, Kang W, Lim H, Lee J
Oncotarget 2015;8(57):96656-96667
Oncotarget 2015;8(57):96656-96667
No comments: Submit comment
No validations: Submit validation data