Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010461-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010461-M01, RRID:AB_436992
- Product name
- MERTK monoclonal antibody (M01), clone 2D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MERTK.
- Antigen sequence
AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPH
ASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKP
LPPLAFKHTVGHIILSEHKGVKFNCSINVP- Isotype
- IgG
- Antibody clone number
- 2D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Biomimetic collagen I and IV double layer Langmuir-Schaefer films as microenvironment for human pluripotent stem cell derived retinal pigment epithelial cells.
Generation of hESC-derived retinal pigment epithelium on biopolymer coated polyimide membranes.
Sorkio AE, Vuorimaa-Laukkanen EP, Hakola HM, Liang H, Ujula TA, Valle-Delgado JJ, Österberg M, Yliperttula ML, Skottman H
Biomaterials 2015 May;51:257-69
Biomaterials 2015 May;51:257-69
Generation of hESC-derived retinal pigment epithelium on biopolymer coated polyimide membranes.
Subrizi A, Hiidenmaa H, Ilmarinen T, Nymark S, Dubruel P, Uusitalo H, Yliperttula M, Urtti A, Skottman H
Biomaterials 2012 Nov;33(32):8047-54
Biomaterials 2012 Nov;33(32):8047-54
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MERTK is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol