HPA029949

SASH1 antibody from MilliporeSigma / Merck KGaA
dJ323M4.1, KIAA0790, SH3D6A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029949
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029949, RRID:AB_10602280
Product name
Anti-SASH1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029949
Antibody type
Polyclonal
Antigen
SAM and SH3 domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KGEDVGYVASEITMSDEERIQLMMMVKEKMITIEE
ALARLKEYEAQHRQSAALDPADWPDGSYPTFDGSS
NCNSREQSDDETE
Storage
-20C
Provider Type Product Number
- No reagents -