Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000761-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000761-M02, RRID:AB_437014
- Product name
- CA3 monoclonal antibody (M02), clone 4A12-1A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant CA3.
- Antigen sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHT
KDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVF
DDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGS
EHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGI
AVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPF
TKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLL
LKEPMTVSSDQMAKLRSLLPSAENEPPVPLVSNWR
PPQPINNRVVRASFK- Isotype
- IgG
- Antibody clone number
- 4A12-1A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression of CAIII and Hsp70 Is Increased the Mucous Membrane of the Posterior Commissure in Laryngopharyngeal Reflux Disease.
The human cardiac and skeletal muscle proteomes defined by transcriptomics and antibody-based profiling.
Proteomic profiling of antisense-induced exon skipping reveals reversal of pathobiochemical abnormalities in dystrophic mdx diaphragm.
Min HJ, Hong SC, Yang HS, Mun SK, Lee SY
Yonsei medical journal 2016 Mar;57(2):469-74
Yonsei medical journal 2016 Mar;57(2):469-74
The human cardiac and skeletal muscle proteomes defined by transcriptomics and antibody-based profiling.
Lindskog C, Linné J, Fagerberg L, Hallström BM, Sundberg CJ, Lindholm M, Huss M, Kampf C, Choi H, Liem DA, Ping P, Väremo L, Mardinoglu A, Nielsen J, Larsson E, Pontén F, Uhlén M
BMC genomics 2015 Jun 25;16(1):475
BMC genomics 2015 Jun 25;16(1):475
Proteomic profiling of antisense-induced exon skipping reveals reversal of pathobiochemical abnormalities in dystrophic mdx diaphragm.
Doran P, Wilton SD, Fletcher S, Ohlendieck K
Proteomics 2009 Feb;9(3):671-85
Proteomics 2009 Feb;9(3):671-85
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CA3 monoclonal antibody (M02), clone 4A12-1A3 Western Blot analysis of CA3 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CA3 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CA3 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol