HPA026700

CA3 antibody from Sigma-Aldrich
CAIII, Car3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026700
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026700, RRID:AB_1845991
Product name
Anti-CA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026700
Antibody type
Polyclonal
Antigen
Carbonic anhydrase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAK
LRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASF
K
Storage
-20C
Provider Type Product Number
- No reagents -