HPA003152

ZNF773 antibody from Atlas Antibodies
MGC4728, ZNF419B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003152
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003152, RRID:AB_889124
Product name
Anti-ZNF773
Provider product page
Atlas Antibodies - HPA003152
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EITQLESWEEPFMPAWEVVTSAILRGSWQGAKAEA
AAEQSASVEVPSSNVQQHQKQHCGEKPLKRQEGRV
PVLRSCRVHLSEKSLQSREVGKDLLTSSGVLKHQV
THTGEKSHRSSKSRE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -