HPA003152

ZNF773 antibody from Sigma-Aldrich
MGC4728, ZNF419B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003152
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003152, RRID:AB_1080716
Product name
Anti-ZNF773 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003152
Antibody type
Polyclonal
Antigen
Zinc finger protein 419B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EITQLESWEEPFMPAWEVVTSAILRGSWQGAKAEA
AAEQSASVEVPSSNVQQHQKQHCGEKPLKRQEGRV
PVLRSCRVHLSEKSLQSREVGKDLLTSSGVLKHQV
THTGEKSHRSSKSRE
Storage
-20C
Provider Type Product Number
- No reagents -