Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001573-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001573-M01, RRID:AB_490089
- Product name
- CYP2J2 monoclonal antibody (M01), clone 2D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CYP2J2.
- Antigen sequence
LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFS
IGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNE
KLSLKFRMGITISPVSHRLCA- Isotype
- IgG
- Antibody clone number
- 2D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Investigating the contribution of CYP2J2 to ritonavir metabolism in vitro and in vivo.
Identifying a selective substrate and inhibitor pair for the evaluation of CYP2J2 activity.
Cytochrome P450 subfamily 2J polypeptide 2 expression and circulating epoxyeicosatrienoic metabolites in preeclampsia.
Detection of EETs and HETE-generating cytochrome P-450 enzymes and the effects of their metabolites on myometrial and vascular function.
Kaspera R, Kirby BJ, Sahele T, Collier AC, Kharasch ED, Unadkat JD, Totah RA
Biochemical pharmacology 2014 Sep 1;91(1):109-18
Biochemical pharmacology 2014 Sep 1;91(1):109-18
Identifying a selective substrate and inhibitor pair for the evaluation of CYP2J2 activity.
Lee CA, Jones JP 3rd, Katayama J, Kaspera R, Jiang Y, Freiwald S, Smith E, Walker GS, Totah RA
Drug metabolism and disposition: the biological fate of chemicals 2012 May;40(5):943-51
Drug metabolism and disposition: the biological fate of chemicals 2012 May;40(5):943-51
Cytochrome P450 subfamily 2J polypeptide 2 expression and circulating epoxyeicosatrienoic metabolites in preeclampsia.
Herse F, Lamarca B, Hubel CA, Kaartokallio T, Lokki AI, Ekholm E, Laivuori H, Gauster M, Huppertz B, Sugulle M, Ryan MJ, Novotny S, Brewer J, Park JK, Kacik M, Hoyer J, Verlohren S, Wallukat G, Rothe M, Luft FC, Muller DN, Schunck WH, Staff AC, Dechend R
Circulation 2012 Dec 18;126(25):2990-9
Circulation 2012 Dec 18;126(25):2990-9
Detection of EETs and HETE-generating cytochrome P-450 enzymes and the effects of their metabolites on myometrial and vascular function.
Pearson T, Warren AY, Barrett DA, Khan RN
American journal of physiology. Endocrinology and metabolism 2009 Sep;297(3):E647-56
American journal of physiology. Endocrinology and metabolism 2009 Sep;297(3):E647-56
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CYP2J2 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol