HPA006491

ZSCAN4 antibody from Sigma-Aldrich
FLJ35105, ZNF494
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006491
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006491, RRID:AB_10603385
Product name
Anti-ZSCAN4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006491
Antibody type
Polyclonal
Antigen
zinc finger and SCAN domain containing 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CNDKASVKEKWKSSGKNLERFIEDLTDDSINPPAL
VHVHMQGQEALFSEDMPLRDVIVHLTKQVNAQTTR
EANMGTPSQTSQDTSLETGQGYEDEQDGWNSSSKT
TRVNENITNQGNQIVSLIIIQE
Storage
-20C
Provider Type Product Number
- No reagents -