Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00132243-B01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00132243-B01, RRID:AB_1138411
- Product name
- H1FOO MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human H1FOO protein.
- Antigen sequence
MAPATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVK
KAAKRPAKVQKPPPKPGAATEKARKQGGAAKDTRA
QSGEARKVPPKPDKAMRAPSSAGGLSRKAKAKGSR
SSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTK
KKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAH
LSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of H1FOO expression in transfected 293T cell line (H00132243-T01) by H1FOO MaxPab polyclonal antibody.Lane 1: H1FOO transfected lysate(22.77 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to H1FOO on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol