Antibody data

Product number
H00348995-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00348995-M03, RRID:AB_1137335
Product name
NUP43 monoclonal antibody (M03), clone 2G5
Provider product page
Abnova Corporation - H00348995-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NUP43.
Antigen sequence
SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHS
ISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRS
LSVNTLDVLGPCLVCGTDAEAIYVTRHLFS
Isotype
IgG
Antibody clone number
2G5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -