HPA031366

antibody from Atlas Antibodies

Targeting: C1orf87 CREF, MGC34837

Antibody data

Submit

Validation data

Product number: HPA031366 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA031366, RRID:AB_2673847
Product name: Anti-C1orf87
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ALRTTNGRLNIDNLNLSFRKEDRSFSGCLPLPKVR AICGKHGLYLTLSLLETLLNHQDLGYQNEIKWQNF VEMLTRASSDLLSDLPTGKNEKK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

C1orf87 protein structure - HPA031366 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and placenta tissues using Anti-C1orf87 antibody. Corresponding C1orf87 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human fallopian tube, kidney, lymph node and testis using Anti-C1orf87 antibody HPA031366 (A) shows similar protein distribution across tissues to independent antibody HPA031368 (B).
Antibody #2 product nr: HPA031368
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows distinct positivity in cilia.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-C1orf87 antibody HPA031366.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-C1orf87 antibody HPA031366.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-C1orf87 antibody HPA031366.
Sample type: HUMAN