Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311350 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 418 (ZNF418) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF418 antibody: synthetic peptide directed towards the N terminal of human ZNF418
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
HRCEAWGNKLYDSSNRPHQNQYLGEKPYRSSVEEA
LFVKR CKFHVSEESS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references ZNF418, a novel human KRAB/C2H2 zinc finger protein, suppresses MAPK signaling pathway.
Li Y, Yang D, Bai Y, Mo X, Huang W, Yuan W, Yin Z, Deng Y, Murashko O, Wang Y, Fan X, Zhu C, Ocorr K, Bodmer R, Wu X
Molecular and cellular biochemistry 2008 Mar;310(1-2):141-51
Molecular and cellular biochemistry 2008 Mar;310(1-2):141-51
No comments: Submit comment
No validations: Submit validation data