H00135250-M01

RAET1E antibody from Abnova Corporation
bA350J20.7, LETAL, ULBP4

Antibody data

Product number
H00135250-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00135250-M01, RRID:AB_1579520
Product name
RAET1E monoclonal antibody (M01), clone 2D11
Provider product page
Abnova Corporation - H00135250-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RAET1E.
Antigen sequence
NFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNM
VKPLGLLGKKVNATSTWGELTQTLGEVGRDLRMLL
CDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQF
ATNGE
Isotype
IgG
Antibody clone number
2D11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -