PAB20315

RTL6 antibody from Abnova Corporation
dJ1033E15.2, DKFZp761O17121, LDOC1L, Mar6, Mart6, SIRH3

Antibody data

Product number
PAB20315
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20315, RRID:AB_10964343
Product name
LDOC1L polyclonal antibody
Provider product page
Abnova Corporation - PAB20315
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant LDOC1L.
Antigen sequence
SVMAELTLLRTRARIPGALQITPPISSITSNGTRP
MTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQAS
RFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLR
NNYQGF
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -